PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g042460m
Common NameCISIN_1g042460mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family GRAS
Protein Properties Length: 730aa    MW: 81549.4 Da    PI: 7.2563
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g042460mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS309.86.2e-9538672822374
               GRAS  22 alLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqaIleavegeervH 113
                        ++Larl++++ p g+p+qR+a+yf+eAL+  l+   +++ +  pp++ ++ +++ ++ a+k+fsevsP+++f ++t+Nqa+lea++ ++r+H
  orange1.1g042460m 386 RILARLNHQVFPVGKPLQRAAFYFKEALQLFLLM-NNQVTN-PPPRSPTPVDVIFKMGAYKVFSEVSPLIQFINFTCNQALLEALDDADRIH 475
                        79******************************97.556654.5666666799**************************************** PP

               GRAS 114 iiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledl..eleeLrvkpgEal 202
                        i+Dfdi+ G+QW++++q+L+ R+ +g+ps++iT+++sp+++++ el  ++e+L++fA+++gv+f+ +v+  ++l++   +l  ++ +++Ea+
  orange1.1g042460m 476 IVDFDIGFGAQWASFMQELSMRSnRGTPSMKITAFASPSTHHHIELGLMRENLTQFANAIGVSFDLDVINFESLDQTsyTLPIIQSSENEAV 567
                        **********************9899*******************************************8888877733566789999**** PP

               GRAS 203 aVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgrei 294
                        aVn+ +   +  +++ +l+s    +L++vk+lsPk+vv +++ +d ++ +F e++l+al+ y  l++sl+a      ++ +k+Er+ll+++i
  orange1.1g042460m 568 AVNFPI--WSSSNQPSALPS----LLRFVKQLSPKIVVSADRGCDKSDLPFPEHILHALQSYINLLESLDAV-NVMPDALNKIERFLLQPRI 652
                        ****99..444445666666....*********************************************665.34558899*********** PP

               GRAS 295 vnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                        ++vv  + +       ++  W+  + +aGF+pv++s+++++qa++++++++++g++ve++++slvl+W++r+L+s+SaWr
  orange1.1g042460m 653 ESVVLGRLRG----PDRMPMWKTLFASAGFSPVTFSNFTETQAECVVKRTPVRGFHVEKRQASLVLCWQQRELISASAWR 728
                        *****99888....89999************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098541.021338708IPR005202Transcription factor GRAS
PfamPF035142.1E-92386728IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 730 aa     Download sequence    Send to blast
MSVPSHLQEK CVFKIQDFTP ICSQGKWKQK HQQQQQVNNN SFCFSCNIDN EPTSVLHMRR  60
SQSPPTSAST LSSSLNNTNT TTTNSVPQEP VSPLLNNERK DEWATELLSM PNGLEVIPTG  120
AERCGLGLED WETMLSESGQ EQSILKWIAG DVDDSPFGLK QLLQSWRKWE CLASGNFIAT  180
NLCAFPGSEL LSNNNGNGKI GSSPGLVNLN HKVVSGVGLN SSNSNNNCNY QNPIFGSPTS  240
SNVSLAPVSL PPGVNIQQSQ NFVEAPEEKP QILNPQIFMN NQQVQSQHHQ NPNFFFPVSA  300
YPLHQENHHH SHLLQPQPKR HNSGGSLDLS SPHVPKPPFS DPRHEFLLRN HQQQMGFYQN  360
VHFLPQHFQQ KSLIVSAKQK VLSPGRILAR LNHQVFPVGK PLQRAAFYFK EALQLFLLMN  420
NQVTNPPPRS PTPVDVIFKM GAYKVFSEVS PLIQFINFTC NQALLEALDD ADRIHIVDFD  480
IGFGAQWASF MQELSMRSNR GTPSMKITAF ASPSTHHHIE LGLMRENLTQ FANAIGVSFD  540
LDVINFESLD QTSYTLPIIQ SSENEAVAVN FPIWSSSNQP SALPSLLRFV KQLSPKIVVS  600
ADRGCDKSDL PFPEHILHAL QSYINLLESL DAVNVMPDAL NKIERFLLQP RIESVVLGRL  660
RGPDRMPMWK TLFASAGFSP VTFSNFTETQ AECVVKRTPV RGFHVEKRQA SLVLCWQQRE  720
LISASAWRC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-333717286375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006477215.10.0PREDICTED: scarecrow-like protein 27
TrEMBLA0A067F2930.0A0A067F293_CITSI; Uncharacterized protein
STRINGPOPTR_0003s11020.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16534813
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.11e-122GRAS family protein